Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,823
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 7,317
  3. Avatar for BearCorp 13. BearCorp 1 pt. 4,858

  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 8 pts. 10,391
  2. Avatar for georg137 32. georg137 Lv 1 7 pts. 10,354
  3. Avatar for stomjoh 33. stomjoh Lv 1 6 pts. 10,341
  4. Avatar for Anfinsen_slept_here 34. Anfinsen_slept_here Lv 1 5 pts. 10,331
  5. Avatar for Joanna_H 35. Joanna_H Lv 1 5 pts. 10,324
  6. Avatar for TheGUmmer 36. TheGUmmer Lv 1 4 pts. 10,288
  7. Avatar for Dr.Sillem 37. Dr.Sillem Lv 1 4 pts. 10,240
  8. Avatar for BarrySampson 38. BarrySampson Lv 1 3 pts. 10,237
  9. Avatar for pfirth 39. pfirth Lv 1 3 pts. 10,206
  10. Avatar for hada 40. hada Lv 1 3 pts. 10,190

Comments