Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,823
  2. Avatar for CBE_ProEn_2025 12. CBE_ProEn_2025 1 pt. 7,317
  3. Avatar for BearCorp 13. BearCorp 1 pt. 4,858

  1. Avatar for Jakub332 71. Jakub332 Lv 1 1 pt. 7,257
  2. Avatar for genshinimpact37 72. genshinimpact37 Lv 1 1 pt. 4,865
  3. Avatar for Bletchley Park 73. Bletchley Park Lv 1 1 pt. 4,858
  4. Avatar for Russbear 74. Russbear Lv 1 1 pt. 4,858

Comments