Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,864
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,831
  3. Avatar for Contenders 3. Contenders 41 pts. 10,767
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 10,628
  5. Avatar for Australia 5. Australia 14 pts. 10,591
  6. Avatar for VeFold 6. VeFold 7 pts. 10,538
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,498
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,457
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,324
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,288

  1. Avatar for Apothecary1815 41. Apothecary1815 Lv 1 2 pts. 10,152
  2. Avatar for Alistair69 42. Alistair69 Lv 1 2 pts. 10,149
  3. Avatar for ProfVince 43. ProfVince Lv 1 2 pts. 10,142
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 2 pts. 10,131
  5. Avatar for Wanderer09 45. Wanderer09 Lv 1 1 pt. 10,072
  6. Avatar for rosie4loop 46. rosie4loop Lv 1 1 pt. 10,071
  7. Avatar for toshiue 47. toshiue Lv 1 1 pt. 10,047
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 10,020
  9. Avatar for ZiiONIC 49. ZiiONIC Lv 1 1 pt. 9,986
  10. Avatar for jamestpierce 50. jamestpierce Lv 1 1 pt. 9,848

Comments