Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since 3 months ago

Novice Overall Prediction

Summary


Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Go Science 100 pts. 10,864
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,831
  3. Avatar for Contenders 3. Contenders 41 pts. 10,767
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 10,628
  5. Avatar for Australia 5. Australia 14 pts. 10,591
  6. Avatar for VeFold 6. VeFold 7 pts. 10,538
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,498
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,457
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,324
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,288

  1. Avatar for matt61ger 51. matt61ger Lv 1 1 pt. 9,843
  2. Avatar for Savas 52. Savas Lv 1 1 pt. 9,823
  3. Avatar for Zo2uEv7lPR 53. Zo2uEv7lPR Lv 1 1 pt. 9,819
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 1 pt. 9,805
  5. Avatar for Trajan464 55. Trajan464 Lv 1 1 pt. 9,802
  6. Avatar for Larini 56. Larini Lv 1 1 pt. 9,763
  7. Avatar for p.naka 57. p.naka Lv 1 1 pt. 9,735
  8. Avatar for Phoenix38 58. Phoenix38 Lv 1 1 pt. 9,618
  9. Avatar for Mohoernchen 59. Mohoernchen Lv 1 1 pt. 9,577
  10. Avatar for zbp 60. zbp Lv 1 1 pt. 9,502

Comments