Icon representing a puzzle

2710: Revisiting Puzzle 68: Bos Taurus

Closed since about 2 months ago

Novice Overall Prediction

Summary

Created
January 07, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,864
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 10,831
  3. Avatar for Contenders 3. Contenders 41 pts. 10,767
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 10,628
  5. Avatar for Australia 5. Australia 14 pts. 10,591
  6. Avatar for VeFold 6. VeFold 7 pts. 10,538
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,498
  8. Avatar for SETI.Germany 8. SETI.Germany 2 pts. 10,457
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,324
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,288
  1. Avatar for Aubade01 11. Aubade01 Lv 1 48 pts. 10,674
  2. Avatar for Galaxie 12. Galaxie Lv 1 45 pts. 10,658
  3. Avatar for westchuck 13. westchuck Lv 1 41 pts. 10,638
  4. Avatar for Dr. Goochie 14. Dr. Goochie Lv 1 38 pts. 10,634
  5. Avatar for Aarav_Awasthi 15. Aarav_Awasthi Lv 1 35 pts. 10,633
  6. Avatar for nicobul 16. nicobul Lv 1 32 pts. 10,628
  7. Avatar for christioanchauvin 17. christioanchauvin Lv 1 30 pts. 10,613
  8. Avatar for akaaka 18. akaaka Lv 1 27 pts. 10,611
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 25 pts. 10,591
  10. Avatar for silent gene 20. silent gene Lv 1 23 pts. 10,591

Comments