Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary

Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups

  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539
  1. Avatar for ichwilldiesennamen
    1. ichwilldiesennamen Lv 1
    100 pts. 25,900
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 25,881
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 87 pts. 25,877
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 81 pts. 25,838
  5. Avatar for grogar7 5. grogar7 Lv 1 75 pts. 25,834
  6. Avatar for Galaxie 6. Galaxie Lv 1 70 pts. 25,789
  7. Avatar for Dr. Goochie 7. Dr. Goochie Lv 1 64 pts. 25,788
  8. Avatar for LociOiling 8. LociOiling Lv 1 60 pts. 25,782
  9. Avatar for drjr 9. drjr Lv 1 55 pts. 25,767
  10. Avatar for dpmattingly 10. dpmattingly Lv 1 51 pts. 25,763

Comments