Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary

Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups

  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 25,923
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 60 pts. 25,921
  3. Avatar for toshiue 3. toshiue Lv 1 33 pts. 25,911
  4. Avatar for silent gene 4. silent gene Lv 1 17 pts. 25,871
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 8 pts. 25,865
  6. Avatar for Galaxie 6. Galaxie Lv 1 4 pts. 25,854
  7. Avatar for nicobul 7. nicobul Lv 1 2 pts. 25,853
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 1 pt. 25,851
  9. Avatar for BootsMcGraw 9. BootsMcGraw Lv 1 1 pt. 25,829
  10. Avatar for LociOiling 10. LociOiling Lv 1 1 pt. 25,828

Comments