Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups


  1. Avatar for Go Science 100 pts. 25,923
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 60 pts. 25,877
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 33 pts. 25,854
  4. Avatar for Contenders 4. Contenders 17 pts. 25,851
  5. Avatar for VeFold 5. VeFold 8 pts. 25,670
  6. Avatar for Australia 6. Australia 4 pts. 25,596
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 25,571
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 25,537
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 25,518
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 25,213

  1. Avatar for Apothecary1815 71. Apothecary1815 Lv 1 1 pt. 8,289

Comments