Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since 2 months ago

Novice Overall Prediction

Summary


Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 9,899
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,885

  1. Avatar for christioanchauvin 100 pts. 11,227
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 95 pts. 11,222
  3. Avatar for Serca 3. Serca Lv 1 89 pts. 11,214
  4. Avatar for akaaka 4. akaaka Lv 1 84 pts. 11,206
  5. Avatar for LociOiling 5. LociOiling Lv 1 79 pts. 11,206
  6. Avatar for grogar7 6. grogar7 Lv 1 75 pts. 11,196
  7. Avatar for drjr 7. drjr Lv 1 70 pts. 11,193
  8. Avatar for dpmattingly 8. dpmattingly Lv 1 66 pts. 11,193
  9. Avatar for bravosk8erboy 9. bravosk8erboy Lv 1 62 pts. 11,182
  10. Avatar for ichwilldiesennamen 10. ichwilldiesennamen Lv 1 58 pts. 11,174

Comments