Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since about 1 month ago

Novice Overall Prediction

Summary


Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 9,899
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,885

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 27 pts. 11,097
  2. Avatar for Dr.Sillem 22. Dr.Sillem Lv 1 25 pts. 11,089
  3. Avatar for g_b 23. g_b Lv 1 23 pts. 11,068
  4. Avatar for silent gene 24. silent gene Lv 1 22 pts. 11,017
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 20 pts. 11,011
  6. Avatar for drumpeter18yrs9yrs 26. drumpeter18yrs9yrs Lv 1 18 pts. 10,917
  7. Avatar for stomjoh 27. stomjoh Lv 1 17 pts. 10,913
  8. Avatar for Elfi 28. Elfi Lv 1 16 pts. 10,869
  9. Avatar for gmn 29. gmn Lv 1 14 pts. 10,822
  10. Avatar for Tian00 30. Tian00 Lv 1 13 pts. 10,766

Comments