Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since 2 months ago

Novice Overall Prediction

Summary


Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 9,899
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,885

  1. Avatar for hada 31. hada Lv 1 12 pts. 10,756
  2. Avatar for heather-1 32. heather-1 Lv 1 11 pts. 10,740
  3. Avatar for zxspectrum 33. zxspectrum Lv 1 10 pts. 10,734
  4. Avatar for AlphaFold2 34. AlphaFold2 Lv 1 9 pts. 10,731
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 9 pts. 10,726
  6. Avatar for Fasodankfds 36. Fasodankfds Lv 1 8 pts. 10,715
  7. Avatar for carxo 37. carxo Lv 1 7 pts. 10,679
  8. Avatar for jamestpierce 38. jamestpierce Lv 1 7 pts. 10,679
  9. Avatar for Joanna_H 39. Joanna_H Lv 1 6 pts. 10,674
  10. Avatar for BarrySampson 40. BarrySampson Lv 1 5 pts. 10,625

Comments