Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 11,227
  2. Avatar for Go Science 2. Go Science 63 pts. 11,214
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 11,206
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 11,136
  5. Avatar for Australia 5. Australia 11 pts. 11,102
  6. Avatar for VeFold 6. VeFold 5 pts. 11,101
  7. Avatar for Contenders 7. Contenders 2 pts. 11,097
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,011
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,674
  10. Avatar for CBE_ProEn_2025 10. CBE_ProEn_2025 1 pt. 10,285
  1. Avatar for nicobul
    1. nicobul Lv 1
    100 pts. 11,226
  2. Avatar for toshiue 2. toshiue Lv 1 52 pts. 11,205
  3. Avatar for LociOiling 3. LociOiling Lv 1 24 pts. 11,202
  4. Avatar for silent gene 4. silent gene Lv 1 10 pts. 11,201
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 4 pts. 11,198
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 1 pt. 11,197
  7. Avatar for Galaxie 7. Galaxie Lv 1 1 pt. 11,184
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 1 pt. 10,995
  9. Avatar for Anfinsen_slept_here 9. Anfinsen_slept_here Lv 1 1 pt. 10,759

Comments