Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since about 2 months ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,566

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,768
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,761
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 87 pts. 10,738
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 81 pts. 10,709
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 75 pts. 10,623
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 70 pts. 10,607
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 64 pts. 10,582
  8. Avatar for Galaxie 8. Galaxie Lv 1 60 pts. 10,567
  9. Avatar for grogar7 9. grogar7 Lv 1 55 pts. 10,566
  10. Avatar for akaaka 10. akaaka Lv 1 51 pts. 10,562

Comments