Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since about 2 months ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,566

  1. Avatar for drjr 21. drjr Lv 1 19 pts. 10,309
  2. Avatar for Crossed Sticks 22. Crossed Sticks Lv 1 17 pts. 10,275
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 16 pts. 10,270
  4. Avatar for zxspectrum 24. zxspectrum Lv 1 14 pts. 10,254
  5. Avatar for Wanderer09 25. Wanderer09 Lv 1 13 pts. 10,184
  6. Avatar for BootsMcGraw 26. BootsMcGraw Lv 1 11 pts. 10,183
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 10 pts. 10,163
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 9 pts. 10,162
  9. Avatar for stomjoh 29. stomjoh Lv 1 8 pts. 10,141
  10. Avatar for heather-1 30. heather-1 Lv 1 7 pts. 9,965

Comments