Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since 27 days ago

Novice Overall Prediction

Summary

Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,566
  1. Avatar for vybi 31. vybi Lv 1 7 pts. 9,952
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 6 pts. 9,929
  3. Avatar for Fasodankfds 33. Fasodankfds Lv 1 5 pts. 9,899
  4. Avatar for Pazithi 34. Pazithi Lv 1 5 pts. 9,853
  5. Avatar for jausmh 35. jausmh Lv 1 4 pts. 9,759
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 4 pts. 9,745
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 3 pts. 9,655
  8. Avatar for Vinara 38. Vinara Lv 1 3 pts. 9,624
  9. Avatar for kitek314_pl 39. kitek314_pl Lv 1 2 pts. 9,566
  10. Avatar for hada 40. hada Lv 1 2 pts. 9,537

Comments