Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since 27 days ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,566

  1. Avatar for abiogenesis 41. abiogenesis Lv 1 2 pts. 9,516
  2. Avatar for Larini 42. Larini Lv 1 2 pts. 9,492
  3. Avatar for carxo 43. carxo Lv 1 2 pts. 9,487
  4. Avatar for ZiiONIC 44. ZiiONIC Lv 1 1 pt. 9,481
  5. Avatar for gmn 45. gmn Lv 1 1 pt. 9,455
  6. Avatar for Trajan464 46. Trajan464 Lv 1 1 pt. 9,327
  7. Avatar for pfirth 47. pfirth Lv 1 1 pt. 9,295
  8. Avatar for Wildice1100 48. Wildice1100 Lv 1 1 pt. 9,256
  9. Avatar for Joanna_H 49. Joanna_H Lv 1 1 pt. 9,140
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 9,024

Comments