Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since 28 days ago

Novice Overall Prediction

Summary

Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,566
  1. Avatar for TranKhue 51. TranKhue Lv 1 1 pt. 9,020
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 8,996
  3. Avatar for drumpeter18yrs9yrs 53. drumpeter18yrs9yrs Lv 1 1 pt. 8,987
  4. Avatar for haleyg 54. haleyg Lv 1 1 pt. 8,890
  5. Avatar for gmeleos 55. gmeleos Lv 1 1 pt. 8,872
  6. Avatar for QuirksOfMind 56. QuirksOfMind Lv 1 1 pt. 8,870
  7. Avatar for DScott 57. DScott Lv 1 1 pt. 8,746
  8. Avatar for Stas Gunko 58. Stas Gunko Lv 1 1 pt. 8,722
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 8,722
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 8,635

Comments