Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since about 2 months ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,768
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,761
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 10,582
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,542
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 10,473
  6. Avatar for Australia 6. Australia 4 pts. 10,430
  7. Avatar for VeFold 7. VeFold 2 pts. 10,395
  8. Avatar for Contenders 8. Contenders 1 pt. 10,183
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,853
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,759

  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 47 pts. 10,542
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 43 pts. 10,525
  3. Avatar for TheGUmmer 13. TheGUmmer Lv 1 40 pts. 10,473
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 36 pts. 10,430
  5. Avatar for Elfi 15. Elfi Lv 1 33 pts. 10,395
  6. Avatar for silent gene 16. silent gene Lv 1 30 pts. 10,368
  7. Avatar for dpmattingly 17. dpmattingly Lv 1 28 pts. 10,363
  8. Avatar for nicobul 18. nicobul Lv 1 25 pts. 10,358
  9. Avatar for g_b 19. g_b Lv 1 23 pts. 10,328
  10. Avatar for westchuck 20. westchuck Lv 1 21 pts. 10,310

Comments