Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since 29 days ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,768
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,761
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 10,582
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,542
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 10,473
  6. Avatar for Australia 6. Australia 4 pts. 10,430
  7. Avatar for VeFold 7. VeFold 2 pts. 10,395
  8. Avatar for Contenders 8. Contenders 1 pt. 10,183
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,853
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,759

  1. Avatar for vybi 31. vybi Lv 1 7 pts. 9,952
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 6 pts. 9,929
  3. Avatar for Fasodankfds 33. Fasodankfds Lv 1 5 pts. 9,899
  4. Avatar for Pazithi 34. Pazithi Lv 1 5 pts. 9,853
  5. Avatar for jausmh 35. jausmh Lv 1 4 pts. 9,759
  6. Avatar for AlphaFold2 36. AlphaFold2 Lv 1 4 pts. 9,745
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 3 pts. 9,655
  8. Avatar for Vinara 38. Vinara Lv 1 3 pts. 9,624
  9. Avatar for kitek314_pl 39. kitek314_pl Lv 1 2 pts. 9,566
  10. Avatar for hada 40. hada Lv 1 2 pts. 9,537

Comments