Icon representing a puzzle

2725: Revisiting Puzzle 73: Polycystein

Closed since about 2 months ago

Novice Overall Prediction

Summary


Created
February 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,768
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,761
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 10,582
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,542
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 10,473
  6. Avatar for Australia 6. Australia 4 pts. 10,430
  7. Avatar for VeFold 7. VeFold 2 pts. 10,395
  8. Avatar for Contenders 8. Contenders 1 pt. 10,183
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,853
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,759

  1. Avatar for Jimmalas 61. Jimmalas Lv 1 1 pt. 8,534
  2. Avatar for bios1234 62. bios1234 Lv 1 1 pt. 8,496
  3. Avatar for <someone> 63. <someone> Lv 1 1 pt. 8,305
  4. Avatar for zkeyser 64. zkeyser Lv 1 1 pt. 8,003
  5. Avatar for JellyJump 65. JellyJump Lv 1 1 pt. 7,737
  6. Avatar for PointTaken 66. PointTaken Lv 1 1 pt. 5,632
  7. Avatar for Madoka 67. Madoka Lv 1 1 pt. 4,931
  8. Avatar for efull 68. efull Lv 1 1 pt. 4,897
  9. Avatar for toshiue 69. toshiue Lv 1 1 pt. 4,879
  10. Avatar for Maxematician 70. Maxematician Lv 1 1 pt. 4,879

Comments