Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since about 1 month ago

Novice Overall Prediction

Summary


Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 9,847
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 93 pts. 9,822
  3. Avatar for Serca 3. Serca Lv 1 86 pts. 9,804
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 79 pts. 9,799
  5. Avatar for LociOiling 5. LociOiling Lv 1 73 pts. 9,790
  6. Avatar for ichwilldiesennamen 6. ichwilldiesennamen Lv 1 67 pts. 9,770
  7. Avatar for dpmattingly 7. dpmattingly Lv 1 62 pts. 9,735
  8. Avatar for gmn 8. gmn Lv 1 57 pts. 9,708
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 52 pts. 9,702
  10. Avatar for Dr. Goochie 10. Dr. Goochie Lv 1 47 pts. 9,700

Comments