Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 17 days ago

Novice Overall Prediction

Summary

Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626
  1. Avatar for TheGUmmer 11. TheGUmmer Lv 1 43 pts. 9,678
  2. Avatar for westchuck 12. westchuck Lv 1 39 pts. 9,678
  3. Avatar for silent gene 13. silent gene Lv 1 36 pts. 9,673
  4. Avatar for Elfi 14. Elfi Lv 1 33 pts. 9,652
  5. Avatar for nicobul 15. nicobul Lv 1 30 pts. 9,647
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 27 pts. 9,640
  7. Avatar for akaaka 17. akaaka Lv 1 24 pts. 9,636
  8. Avatar for Galaxie 18. Galaxie Lv 1 22 pts. 9,577
  9. Avatar for grogar7 19. grogar7 Lv 1 20 pts. 9,536
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 18 pts. 9,530

Comments