Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 16 pts. 9,519
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 14 pts. 9,470
  3. Avatar for Xendrais 23. Xendrais Lv 1 13 pts. 9,438
  4. Avatar for g_b 24. g_b Lv 1 11 pts. 9,423
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 10 pts. 9,409
  6. Avatar for Wanderer09 26. Wanderer09 Lv 1 9 pts. 9,395
  7. Avatar for zxspectrum 27. zxspectrum Lv 1 8 pts. 9,391
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 7 pts. 9,367
  9. Avatar for heather-1 29. heather-1 Lv 1 6 pts. 9,354

Comments