Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 17 days ago

Novice Overall Prediction

Summary

Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626
  1. Avatar for Idiotboy 31. Idiotboy Lv 1 5 pts. 9,239
  2. Avatar for ProfVince 32. ProfVince Lv 1 4 pts. 9,231
  3. Avatar for drjr 33. drjr Lv 1 4 pts. 9,213
  4. Avatar for jausmh 34. jausmh Lv 1 3 pts. 9,184
  5. Avatar for pfirth 35. pfirth Lv 1 3 pts. 9,165
  6. Avatar for Apothecary1815 36. Apothecary1815 Lv 1 2 pts. 9,142
  7. Avatar for Hellcat6 37. Hellcat6 Lv 1 2 pts. 9,103
  8. Avatar for Fasodankfds 38. Fasodankfds Lv 1 2 pts. 9,096
  9. Avatar for p.naka 39. p.naka Lv 1 2 pts. 8,901
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 1 pt. 8,751

Comments