Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626
  1. Avatar for DScott 51. DScott Lv 1 1 pt. 8,446
  2. Avatar for ZiiONIC 52. ZiiONIC Lv 1 1 pt. 8,390
  3. Avatar for TranKhue 53. TranKhue Lv 1 1 pt. 8,296
  4. Avatar for Tron 54. Tron Lv 1 1 pt. 8,246
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 8,219
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 8,206
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 8,122
  8. Avatar for Painture 58. Painture Lv 1 1 pt. 8,100
  9. Avatar for Jimmalas 59. Jimmalas Lv 1 1 pt. 8,072
  10. Avatar for gmeleos 60. gmeleos Lv 1 1 pt. 7,954

Comments