Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626

  1. Avatar for NickyRuffcut 61. NickyRuffcut Lv 1 1 pt. 7,941
  2. Avatar for efull 62. efull Lv 1 1 pt. 7,914
  3. Avatar for ap2026 63. ap2026 Lv 1 1 pt. 7,735
  4. Avatar for ThElektro 64. ThElektro Lv 1 1 pt. 7,614
  5. Avatar for spvincent 65. spvincent Lv 1 1 pt. 5,878

Comments