Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 17 days ago

Novice Overall Prediction

Summary

Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,847
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,790
  3. Avatar for Australia 3. Australia 33 pts. 9,702
  4. Avatar for Void Crushers 4. Void Crushers 17 pts. 9,678
  5. Avatar for VeFold 5. VeFold 8 pts. 9,652
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,647
  7. Avatar for Contenders 7. Contenders 2 pts. 9,530
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 9,519
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,184
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 8,684
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 9,838
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 41 pts. 9,837
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 14 pts. 9,795
  4. Avatar for silent gene 4. silent gene Lv 1 4 pts. 9,795
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 1 pt. 9,793
  6. Avatar for LociOiling 6. LociOiling Lv 1 1 pt. 9,790
  7. Avatar for Galaxie 7. Galaxie Lv 1 1 pt. 9,790

Comments