Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Go Science 100 pts. 9,847
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,790
  3. Avatar for Australia 3. Australia 33 pts. 9,702
  4. Avatar for Void Crushers 4. Void Crushers 17 pts. 9,678
  5. Avatar for VeFold 5. VeFold 8 pts. 9,652
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,647
  7. Avatar for Contenders 7. Contenders 2 pts. 9,530
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 9,519
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,184
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 8,684

  1. Avatar for kitek314_pl 41. kitek314_pl Lv 1 1 pt. 8,684
  2. Avatar for Th1sN@me!sN0tAPun 42. Th1sN@me!sN0tAPun Lv 1 1 pt. 8,651
  3. Avatar for Savas 43. Savas Lv 1 1 pt. 8,626
  4. Avatar for Wildice1100 44. Wildice1100 Lv 1 1 pt. 8,607
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 8,603
  6. Avatar for RWoodcock 46. RWoodcock Lv 1 1 pt. 8,579
  7. Avatar for pizpot 47. pizpot Lv 1 1 pt. 8,523
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 8,517
  9. Avatar for hada 49. hada Lv 1 1 pt. 8,455
  10. Avatar for Stas Gunko 50. Stas Gunko Lv 1 1 pt. 8,455

Comments