Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary


Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,725

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,199
  2. Avatar for grogar7 2. grogar7 Lv 1 94 pts. 10,194
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 10,191
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 82 pts. 10,182
  5. Avatar for Galaxie 5. Galaxie Lv 1 76 pts. 10,167
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 71 pts. 10,152
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 66 pts. 10,145
  8. Avatar for Dr. Goochie 8. Dr. Goochie Lv 1 61 pts. 10,144
  9. Avatar for akaaka 9. akaaka Lv 1 56 pts. 10,144
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 52 pts. 10,133

Comments