Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 15 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,725
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 48 pts. 10,133
  2. Avatar for BarrySampson 12. BarrySampson Lv 1 45 pts. 10,132
  3. Avatar for dpmattingly 13. dpmattingly Lv 1 41 pts. 10,116
  4. Avatar for ichwilldiesennamen 14. ichwilldiesennamen Lv 1 38 pts. 10,115
  5. Avatar for g_b 15. g_b Lv 1 35 pts. 10,115
  6. Avatar for Elfi 16. Elfi Lv 1 32 pts. 10,085
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 30 pts. 10,085
  8. Avatar for nicobul 18. nicobul Lv 1 27 pts. 10,077
  9. Avatar for Fasodankfds 19. Fasodankfds Lv 1 25 pts. 10,055
  10. Avatar for westchuck 20. westchuck Lv 1 23 pts. 10,052

Comments