Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 10 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,725
  1. Avatar for pizpot 31. pizpot Lv 1 8 pts. 9,969
  2. Avatar for Xendrais 32. Xendrais Lv 1 7 pts. 9,956
  3. Avatar for drjr 33. drjr Lv 1 6 pts. 9,899
  4. Avatar for rosie4loop 34. rosie4loop Lv 1 5 pts. 9,892
  5. Avatar for Larini 35. Larini Lv 1 5 pts. 9,842
  6. Avatar for heather-1 36. heather-1 Lv 1 4 pts. 9,838
  7. Avatar for hada 37. hada Lv 1 4 pts. 9,834
  8. Avatar for pfirth 38. pfirth Lv 1 3 pts. 9,795
  9. Avatar for kitek314_pl 39. kitek314_pl Lv 1 3 pts. 9,729
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 3 pts. 9,727

Comments