Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 13 days ago

Novice Overall Prediction

Summary


Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,725

  1. Avatar for efull 61. efull Lv 1 1 pt. 9,218
  2. Avatar for Stas Gunko 62. Stas Gunko Lv 1 1 pt. 9,206
  3. Avatar for jawz101 63. jawz101 Lv 1 1 pt. 9,182
  4. Avatar for llimona 64. llimona Lv 1 1 pt. 9,171
  5. Avatar for dvteo 65. dvteo Lv 1 1 pt. 9,155
  6. Avatar for DScott 66. DScott Lv 1 1 pt. 9,153
  7. Avatar for symbiote2022 67. symbiote2022 Lv 1 1 pt. 9,150
  8. Avatar for RWoodcock 68. RWoodcock Lv 1 1 pt. 9,127
  9. Avatar for NickyRuffcut 69. NickyRuffcut Lv 1 1 pt. 9,090
  10. Avatar for AlphaFold2 70. AlphaFold2 Lv 1 1 pt. 8,483

Comments