Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 10 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,199
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,196
  3. Avatar for Australia 3. Australia 33 pts. 10,133
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,133
  5. Avatar for VeFold 5. VeFold 8 pts. 10,132
  6. Avatar for Contenders 6. Contenders 4 pts. 10,085
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 10,077
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,014
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,729
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 21 pts. 10,046
  2. Avatar for Wanderer09 22. Wanderer09 Lv 1 19 pts. 10,044
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 17 pts. 10,031
  4. Avatar for gmn 24. gmn Lv 1 16 pts. 10,020
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 14 pts. 10,014
  6. Avatar for silent gene 26. silent gene Lv 1 13 pts. 10,010
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 12 pts. 10,003
  8. Avatar for jausmh 28. jausmh Lv 1 10 pts. 10,002
  9. Avatar for zxspectrum 29. zxspectrum Lv 1 9 pts. 9,988
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 8 pts. 9,978

Comments