Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 10 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,199
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,196
  3. Avatar for Australia 3. Australia 33 pts. 10,133
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,133
  5. Avatar for VeFold 5. VeFold 8 pts. 10,132
  6. Avatar for Contenders 6. Contenders 4 pts. 10,085
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 10,077
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,014
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,729
  1. Avatar for Cagdason 41. Cagdason Lv 1 2 pts. 9,725
  2. Avatar for carxo 42. carxo Lv 1 2 pts. 9,690
  3. Avatar for zbp 43. zbp Lv 1 2 pts. 9,676
  4. Avatar for ProfVince 44. ProfVince Lv 1 2 pts. 9,671
  5. Avatar for CassowaryDyke 45. CassowaryDyke Lv 1 1 pt. 9,661
  6. Avatar for p.naka 46. p.naka Lv 1 1 pt. 9,645
  7. Avatar for ZiiONIC 47. ZiiONIC Lv 1 1 pt. 9,644
  8. Avatar for Trajan464 48. Trajan464 Lv 1 1 pt. 9,585
  9. Avatar for Hellcat6 49. Hellcat6 Lv 1 1 pt. 9,524
  10. Avatar for TranKhue 50. TranKhue Lv 1 1 pt. 9,487

Comments