Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 10 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,199
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 10,196
  3. Avatar for Australia 3. Australia 33 pts. 10,133
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 10,133
  5. Avatar for VeFold 5. VeFold 8 pts. 10,132
  6. Avatar for Contenders 6. Contenders 4 pts. 10,085
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 2 pts. 10,077
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 10,014
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,002
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,729
  1. Avatar for LAPUZZAANDREA 51. LAPUZZAANDREA Lv 1 1 pt. 9,466
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 9,362
  3. Avatar for Apothecary1815 53. Apothecary1815 Lv 1 1 pt. 9,310
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 9,306
  5. Avatar for visyix 55. visyix Lv 1 1 pt. 9,291
  6. Avatar for Jimmalas 56. Jimmalas Lv 1 1 pt. 9,286
  7. Avatar for mart0258 57. mart0258 Lv 1 1 pt. 9,283
  8. Avatar for neilsebas 58. neilsebas Lv 1 1 pt. 9,273
  9. Avatar for Painture 59. Painture Lv 1 1 pt. 9,273
  10. Avatar for gmeleos 60. gmeleos Lv 1 1 pt. 9,267

Comments