Icon representing a puzzle

2737: Revisiting Puzzle 77: Copper Chaperone

Closed since 16 days ago

Novice Overall Prediction

Summary

Created
March 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 9,620
  2. Avatar for Team China 12. Team China 1 pt. 8,603
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 49 pts. 10,084
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 45 pts. 10,080
  3. Avatar for Xendrais 13. Xendrais Lv 1 42 pts. 10,058
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 39 pts. 10,053
  5. Avatar for Galaxie 15. Galaxie Lv 1 36 pts. 10,015
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 33 pts. 10,009
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 30 pts. 9,982
  8. Avatar for Wanderer09 18. Wanderer09 Lv 1 28 pts. 9,956
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 25 pts. 9,941
  10. Avatar for silent gene 20. silent gene Lv 1 23 pts. 9,927

Comments

Serca Lv 1

This protein functions as a vital intracellular copper chaperone, acting as a molecular escort that safely transports toxic, highly reactive copper ions through the cell. Structurally, this small protein folds into an "open beta-sandwich" architecture, but its true functional power lies in a highly conserved Cys-X-X-Cys motif located on a flexible loop. Within this motif, two cysteine residues act like chemical "handcuffs," using their sulfur atoms to tightly but reversibly bind a single copper ion, neutralizing its cellular threat before delivering the payload precisely to its target enzyme.