Icon representing a puzzle

2737: Revisiting Puzzle 77: Copper Chaperone

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 1 pt. 9,620
  2. Avatar for Team China 12. Team China 1 pt. 8,603

  1. Avatar for Guiguitare 41. Guiguitare Lv 1 3 pts. 9,397
  2. Avatar for Fasodankfds 42. Fasodankfds Lv 1 2 pts. 9,396
  3. Avatar for rosie4loop 43. rosie4loop Lv 1 2 pts. 9,396
  4. Avatar for heather-1 45. heather-1 Lv 1 2 pts. 9,380
  5. Avatar for Egor Gunko 46. Egor Gunko Lv 1 1 pt. 9,365
  6. Avatar for BURGS69 47. BURGS69 Lv 1 1 pt. 9,339
  7. Avatar for zbp 48. zbp Lv 1 1 pt. 9,316
  8. Avatar for TranKhue 49. TranKhue Lv 1 1 pt. 9,230
  9. Avatar for RichGuilmain 50. RichGuilmain Lv 1 1 pt. 9,136

Comments


Serca Lv 1

This protein functions as a vital intracellular copper chaperone, acting as a molecular escort that safely transports toxic, highly reactive copper ions through the cell. Structurally, this small protein folds into an "open beta-sandwich" architecture, but its true functional power lies in a highly conserved Cys-X-X-Cys motif located on a flexible loop. Within this motif, two cysteine residues act like chemical "handcuffs," using their sulfur atoms to tightly but reversibly bind a single copper ion, neutralizing its cellular threat before delivering the payload precisely to its target enzyme.