Icon representing a puzzle

2737: Revisiting Puzzle 77: Copper Chaperone

Closed since about 22 hours ago

Novice Overall Prediction

Summary

Created
March 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,407
  2. Avatar for Go Science 2. Go Science 52 pts. 10,337
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,165
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 10 pts. 10,080
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 4 pts. 10,009
  6. Avatar for VeFold 6. VeFold 1 pt. 9,695
  7. Avatar for Australia 7. Australia 1 pt. 9,671
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 9,600
  9. Avatar for Contenders 9. Contenders 1 pt. 6,482
  1. Avatar for ZiiONIC 41. ZiiONIC Lv 1 1 pt. 8,993
  2. Avatar for Stas Gunko 42. Stas Gunko Lv 1 1 pt. 8,992
  3. Avatar for Painture 43. Painture Lv 1 1 pt. 8,944
  4. Avatar for p.naka 44. p.naka Lv 1 1 pt. 8,911
  5. Avatar for Mohoernchen 45. Mohoernchen Lv 1 1 pt. 8,879
  6. Avatar for Trajan464 46. Trajan464 Lv 1 1 pt. 8,869
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 8,791
  8. Avatar for gmn 48. gmn Lv 1 1 pt. 8,790
  9. Avatar for Flatfish4u 49. Flatfish4u Lv 1 1 pt. 8,713
  10. Avatar for RWoodcock 50. RWoodcock Lv 1 1 pt. 8,531

Comments

Serca Lv 1

This protein functions as a vital intracellular copper chaperone, acting as a molecular escort that safely transports toxic, highly reactive copper ions through the cell. Structurally, this small protein folds into an "open beta-sandwich" architecture, but its true functional power lies in a highly conserved Cys-X-X-Cys motif located on a flexible loop. Within this motif, two cysteine residues act like chemical "handcuffs," using their sulfur atoms to tightly but reversibly bind a single copper ion, neutralizing its cellular threat before delivering the payload precisely to its target enzyme.