Icon representing a puzzle

2737: Revisiting Puzzle 77: Copper Chaperone

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 11, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,414
  2. Avatar for Go Science 2. Go Science 63 pts. 10,392
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,199
  4. Avatar for VeFold 4. VeFold 21 pts. 10,085
  5. Avatar for Contenders 5. Contenders 11 pts. 10,084
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,080
  7. Avatar for Australia 7. Australia 2 pts. 10,053
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,009
  9. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,638

  1. Avatar for Idiotboy 31. Idiotboy Lv 1 8 pts. 9,728
  2. Avatar for ShadowTactics 32. ShadowTactics Lv 1 7 pts. 9,638
  3. Avatar for jausmh 33. jausmh Lv 1 6 pts. 9,620
  4. Avatar for pizpot 34. pizpot Lv 1 6 pts. 9,614
  5. Avatar for hada 35. hada Lv 1 5 pts. 9,574
  6. Avatar for manu8170 36. manu8170 Lv 1 5 pts. 9,556
  7. Avatar for carxo 37. carxo Lv 1 4 pts. 9,539
  8. Avatar for Apothecary1815 38. Apothecary1815 Lv 1 4 pts. 9,508
  9. Avatar for pfirth 39. pfirth Lv 1 3 pts. 9,481
  10. Avatar for Dr.Sillem 40. Dr.Sillem Lv 1 3 pts. 9,454

Comments


Serca Lv 1

This protein functions as a vital intracellular copper chaperone, acting as a molecular escort that safely transports toxic, highly reactive copper ions through the cell. Structurally, this small protein folds into an "open beta-sandwich" architecture, but its true functional power lies in a highly conserved Cys-X-X-Cys motif located on a flexible loop. Within this motif, two cysteine residues act like chemical "handcuffs," using their sulfur atoms to tightly but reversibly bind a single copper ion, neutralizing its cellular threat before delivering the payload precisely to its target enzyme.