Placeholder image of a protein
Icon representing a puzzle

2741: Electron Density Reconstruction 162

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 11, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2NRE.

Sequence
MSDQQQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTALRKDAAWTLGVNANLPGDIAVRWVKTVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD GCCGAGGUGGUGGAAUUGGUAGACACGCUACCUUGAGGUGGUAGUGCCCAAUAGGGCUUACGGGUUCAAGUCCCGUCCUCGGUACCA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 42,910
  2. Avatar for Contenders 2. Contenders 56 pts. 42,900
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 29 pts. 42,746
  4. Avatar for Go Science 4. Go Science 14 pts. 42,636
  5. Avatar for Australia 5. Australia 6 pts. 42,394
  6. Avatar for VeFold 6. VeFold 2 pts. 42,358
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 42,186
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 42,161
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 40,351
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 37,713
  1. Avatar for silent gene 21. silent gene Lv 1 16 pts. 41,840
  2. Avatar for grogar7 22. grogar7 Lv 1 14 pts. 41,766
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 13 pts. 41,529
  4. Avatar for g_b 24. g_b Lv 1 11 pts. 41,480
  5. Avatar for Xendrais 25. Xendrais Lv 1 10 pts. 41,476
  6. Avatar for Guiguitare 26. Guiguitare Lv 1 9 pts. 41,453
  7. Avatar for toshiue 27. toshiue Lv 1 8 pts. 41,414
  8. Avatar for westchuck 28. westchuck Lv 1 7 pts. 41,354
  9. Avatar for zxspectrum 29. zxspectrum Lv 1 6 pts. 41,116
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 5 pts. 40,838

Comments

BootsMcGraw Lv 1

Why does the DNA look like cooked spaghetti, and not a nice double-helix?

spvincent Lv 1

I think it's RNA rather than DNA (tab reveals Uracil rather than Thymine). And RNA structures tend to rather messier than the clean-looking double helices DNA tends to form. From the PDB entry it looks like this is part of a tRNA molecule which have various weird loops and non-standard nucleotides.

horowsah Staff Lv 1

Yep, RNA- and RNA takes all sorts of shapes as it performs a variety of functions.