2744: Electron Density Reconstruction 163
Closed since 10 days ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- March 17, 2026
- Expires
- Max points
- 100
The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.
- Sequence
- MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD