Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 10 days ago

Novice Novice Overall Overall Prediction Prediction Electron Density Electron Density

Summary

Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 53,502
  2. Avatar for GENE 433 12. GENE 433 1 pt. 51,640
  3. Avatar for fold me 13. fold me 1 pt. 50,808
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 4,420
  1. Avatar for christioanchauvin
    1. christioanchauvin Lv 1
    100 pts. 59,352
  2. Avatar for Dr. Goochie 2. Dr. Goochie Lv 1 93 pts. 59,225
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 85 pts. 59,200
  4. Avatar for akaaka 4. akaaka Lv 1 78 pts. 59,053
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 72 pts. 59,024
  6. Avatar for Galaxie 6. Galaxie Lv 1 66 pts. 58,992
  7. Avatar for spvincent 7. spvincent Lv 1 60 pts. 58,923
  8. Avatar for Elfi 8. Elfi Lv 1 55 pts. 58,920
  9. Avatar for LociOiling 9. LociOiling Lv 1 50 pts. 58,896
  10. Avatar for bravosk8erboy 10. bravosk8erboy Lv 1 46 pts. 58,894

Comments