Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 19 days ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary

Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 53,502
  2. Avatar for GENE 433 12. GENE 433 1 pt. 51,640
  3. Avatar for fold me 13. fold me 1 pt. 50,808
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 4,420
  1. Avatar for jausmh 31. jausmh Lv 1 4 pts. 56,846
  2. Avatar for roarshock 32. roarshock Lv 1 3 pts. 56,751
  3. Avatar for hada 33. hada Lv 1 3 pts. 55,878
  4. Avatar for SWR_DMaster 34. SWR_DMaster Lv 1 3 pts. 55,747
  5. Avatar for abiogenesis 35. abiogenesis Lv 1 2 pts. 55,745
  6. Avatar for zbp 36. zbp Lv 1 2 pts. 55,700
  7. Avatar for Larini 37. Larini Lv 1 2 pts. 55,680
  8. Avatar for Trajan464 38. Trajan464 Lv 1 1 pt. 55,343
  9. Avatar for awa14 39. awa14 Lv 1 1 pt. 55,082
  10. Avatar for BarrySampson 40. BarrySampson Lv 1 1 pt. 54,346

Comments