Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 19 days ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary

Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups

  1. Avatar for Street Smarts 11. Street Smarts 1 pt. 53,502
  2. Avatar for GENE 433 12. GENE 433 1 pt. 51,640
  3. Avatar for fold me 13. fold me 1 pt. 50,808
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 4,420
  1. Avatar for Savas 41. Savas Lv 1 1 pt. 54,221
  2. Avatar for Mohoernchen 42. Mohoernchen Lv 1 1 pt. 54,121
  3. Avatar for Stas Gunko 43. Stas Gunko Lv 1 1 pt. 54,080
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 54,016
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 53,865
  6. Avatar for Fasodankfds 46. Fasodankfds Lv 1 1 pt. 53,614
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 53,544
  8. Avatar for CipherZ 48. CipherZ Lv 1 1 pt. 53,502
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 53,146
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 52,912

Comments