Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 9 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 59,431
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 59,352
  3. Avatar for Go Science 3. Go Science 44 pts. 59,235
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 59,003
  5. Avatar for VeFold 5. VeFold 16 pts. 58,920
  6. Avatar for Australia 6. Australia 9 pts. 58,706
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 57,727
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 57,307
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,846
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 54,221
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 14 pts. 57,727
  2. Avatar for NinjaGreg 22. NinjaGreg Lv 1 13 pts. 57,704
  3. Avatar for Wanderer09 23. Wanderer09 Lv 1 11 pts. 57,677
  4. Avatar for Guiguitare 24. Guiguitare Lv 1 10 pts. 57,619
  5. Avatar for zxspectrum 25. zxspectrum Lv 1 9 pts. 57,543
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 8 pts. 57,470
  7. Avatar for toshiue 27. toshiue Lv 1 7 pts. 57,442
  8. Avatar for TheGUmmer 28. TheGUmmer Lv 1 6 pts. 57,307
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 5 pts. 57,144
  10. Avatar for manu8170 30. manu8170 Lv 1 4 pts. 56,927

Comments