Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 9 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups

  1. Avatar for Contenders
    1. Contenders
    100 pts. 59,431
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 59,352
  3. Avatar for Go Science 3. Go Science 44 pts. 59,235
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 59,003
  5. Avatar for VeFold 5. VeFold 16 pts. 58,920
  6. Avatar for Australia 6. Australia 9 pts. 58,706
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 57,727
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 57,307
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,846
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 54,221
  1. Avatar for Savas 41. Savas Lv 1 1 pt. 54,221
  2. Avatar for Mohoernchen 42. Mohoernchen Lv 1 1 pt. 54,121
  3. Avatar for Stas Gunko 43. Stas Gunko Lv 1 1 pt. 54,080
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 54,016
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 53,865
  6. Avatar for Fasodankfds 46. Fasodankfds Lv 1 1 pt. 53,614
  7. Avatar for rinze 47. rinze Lv 1 1 pt. 53,544
  8. Avatar for CipherZ 48. CipherZ Lv 1 1 pt. 53,502
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 53,146
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 52,912

Comments