Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 2 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups


  1. Avatar for Contenders 100 pts. 59,431
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 59,352
  3. Avatar for Go Science 3. Go Science 44 pts. 59,235
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 59,003
  5. Avatar for VeFold 5. VeFold 16 pts. 58,920
  6. Avatar for Australia 6. Australia 9 pts. 58,706
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 57,727
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 57,307
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,846
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 54,221

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 52,725
  2. Avatar for Cagdason 52. Cagdason Lv 1 1 pt. 51,640
  3. Avatar for junzhe1135 53. junzhe1135 Lv 1 1 pt. 50,808
  4. Avatar for efull 54. efull Lv 1 1 pt. 49,144
  5. Avatar for lconor 55. lconor Lv 1 1 pt. 48,865
  6. Avatar for mengzach 56. mengzach Lv 1 1 pt. 28,349
  7. Avatar for Painture 57. Painture Lv 1 1 pt. 10,687
  8. Avatar for devil_mantis 58. devil_mantis Lv 1 1 pt. 4,420
  9. Avatar for MariBrandtOli 59. MariBrandtOli Lv 1 1 pt. 4,420
  10. Avatar for leonardo2099 60. leonardo2099 Lv 1 1 pt. 4,420

Comments