Placeholder image of a protein
Icon representing a puzzle

2744: Electron Density Reconstruction 163

Closed since 19 days ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary


Created
March 17, 2026
Expires
Max points
100
Description

The structure of this protein complex with several nearly identical chains has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2P32.

Sequence
MGSSHHHHHHSSGLVPRGSHMGLESYAFNLKQTIEDEKLKDKISPEDKKKIEDKCDEILKWLDSNQTAEKEEFEHQQKDLEGLANPIISKLYQSAGGAPPGAAPGGAAGGAGGPTIEEVD

Top groups


  1. Avatar for Contenders 100 pts. 59,431
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 68 pts. 59,352
  3. Avatar for Go Science 3. Go Science 44 pts. 59,235
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 59,003
  5. Avatar for VeFold 5. VeFold 16 pts. 58,920
  6. Avatar for Australia 6. Australia 9 pts. 58,706
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 57,727
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 57,307
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 56,846
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 54,221

  1. Avatar for kellykong 61. kellykong Lv 1 1 pt. 4,420
  2. Avatar for Sciren 62. Sciren Lv 1 1 pt. 4,420

Comments