Icon representing a puzzle

2746: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since 2 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 01, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,931
  2. Avatar for Go Science 2. Go Science 52 pts. 10,824
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,572
  4. Avatar for VeFold 4. VeFold 10 pts. 10,559
  5. Avatar for Contenders 5. Contenders 4 pts. 10,533
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 1 pt. 10,430
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 10,385
  8. Avatar for GENE 433 8. GENE 433 1 pt. 9,985
  9. Avatar for Australia 9. Australia 1 pt. 9,970
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,931
  2. Avatar for Galaxie 2. Galaxie Lv 1 24 pts. 10,925
  3. Avatar for Dr. Goochie 3. Dr. Goochie Lv 1 4 pts. 10,750
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 1 pt. 10,533
  5. Avatar for actiasluna 5. actiasluna Lv 1 1 pt. 10,342

Comments