Icon representing a puzzle

2746: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since 1 day ago

Novice Overall Prediction

Summary


Created
April 01, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,931
  2. Avatar for Go Science 2. Go Science 52 pts. 10,824
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,572
  4. Avatar for VeFold 4. VeFold 10 pts. 10,559
  5. Avatar for Contenders 5. Contenders 4 pts. 10,533
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 1 pt. 10,430
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 10,385
  8. Avatar for GENE 433 8. GENE 433 1 pt. 9,985
  9. Avatar for Australia 9. Australia 1 pt. 9,970

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,931
  2. Avatar for Serca 2. Serca Lv 1 90 pts. 10,824
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 80 pts. 10,818
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 71 pts. 10,669
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 63 pts. 10,572
  6. Avatar for TheGUmmer 6. TheGUmmer Lv 1 55 pts. 10,572
  7. Avatar for Xendrais 7. Xendrais Lv 1 49 pts. 10,559
  8. Avatar for bravosk8erboy 8. bravosk8erboy Lv 1 43 pts. 10,549
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 37 pts. 10,466
  10. Avatar for christioanchauvin 10. christioanchauvin Lv 1 32 pts. 10,430

Comments