Placeholder image of a protein
Icon representing a puzzle

585: CASP10 Target T0722

Closed since almost 14 years ago

Advanced Advanced Advanced Advanced Advanced Advanced Advanced Advanced Advanced Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 25, 2012
Expires
Max points
100
Description

The eleventh CASP10 target is not an easy one. It's 152 residues and none of the alignment programs were able to find good templates for this target. It might be the case that this protein has no homologs. We are giving you 6 templates (in hope that one of them is correct) for now, and will provide you with some server predictions once they are released. More details about this CASP target are in the puzzle comments.

Top groups


  1. Avatar for Geekdo 21. Geekdo 1 pt. 9,856
  2. Avatar for Team China 22. Team China 1 pt. 8,782
  3. Avatar for Freedom Folders 23. Freedom Folders 1 pt. 8,683
  4. Avatar for Mojo Risin' 24. Mojo Risin' 1 pt. 8,342
  5. Avatar for Deleted group 25. Deleted group pts. 7,855
  6. Avatar for Extraterrestrials 26. Extraterrestrials 1 pt. 7,694
  7. Avatar for Penner 27. Penner 1 pt. 7,530
  8. Avatar for 3HelicesBetterThan1 29. 3HelicesBetterThan1 1 pt. 4,172
  9. Avatar for DSN @ Home 30. DSN @ Home 1 pt. 4,172

  1. Avatar for Bautho 101. Bautho Lv 1 14 pts. 10,733
  2. Avatar for Deleted player 102. Deleted player pts. 10,726
  3. Avatar for justjustin 103. justjustin Lv 1 14 pts. 10,716
  4. Avatar for westrel3IRC 104. westrel3IRC Lv 1 13 pts. 10,706
  5. Avatar for phi16 105. phi16 Lv 1 13 pts. 10,693
  6. Avatar for kdieber 106. kdieber Lv 1 13 pts. 10,687
  7. Avatar for lamoille 107. lamoille Lv 1 12 pts. 10,680
  8. Avatar for Schleicher 108. Schleicher Lv 1 12 pts. 10,675
  9. Avatar for heather-1 109. heather-1 Lv 1 12 pts. 10,666
  10. Avatar for micheldeweerd 110. micheldeweerd Lv 1 12 pts. 10,662

Comments


beta_helix Staff Lv 1

Here is the CASP link for this target (showing the amino acid sequence):
http://predictioncenter.org/casp10/target.cgi?id=137
__________________

Here is the sequence logo predicted by the SAM server.

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Leucines at residues 27, 31, 34, 60-61, 73, 82-84, 91-95, 101, 105, 116, 123, 130 & 140 are highly predicted to be in a helix. However, the Leucines at residues 14, 22-23, 150 & 152 are predicted to be anything.
__________________

Link to template PDBs:

http://www.pdb.org/pdb/explore/explore.do?structureId=1gqe
http://www.pdb.org/pdb/explore/explore.do?structureId=1ls4
http://www.pdb.org/pdb/explore/explore.do?structureId=3tul
http://www.pdb.org/pdb/explore/explore.do?structureId=3k29
http://www.pdb.org/pdb/explore/explore.do?structureId=1ya9
http://www.pdb.org/pdb/explore/explore.do?structureId=3lg7

infjamc Lv 1

What's going on with the sequence at the N-terminus? (Is it an added polyhistidine tag, or was it a part of the "natural" sequence?)

beta_helix Staff Lv 1

In fact, the RosettaServer only modeled this sequence:
SSGRENLYFQGAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLL
EKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDV
LSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSL

Although we can't be 100% sure since the CASP10 organizers did not give us any additional information about it. We'll have to see what all the servers did with the first 7 residues.